Rabbit Anti-PTPRF Antibody 350802 from United States Biological | Biocompare.com

Supplier Images

Rabbit Anti-PTPRF Antibody

All lanes: 350802 at 0.5ug/ml Lane 1: HELA Whole Cell Lysate at 40ug Lane 2: A431 Whole Cell Lysate at 40ug Lane 3: A549 Whole Cell Lysate at 40ug Predicted bind size: 240kD Observed bind size: 240kD
Rabbit Anti-PTPRF Antibody

350802 IHC(P): Human Lung Cancer Tissue

Be the first to write a review!

Supplier Page from
United States Biological for
Rabbit Anti-PTPRF Antibody

The Rabbit Anti-PTPRF Antibody from United States Biological is a Rabbit Polyclonal antibody to PTPRF. This antibody recognizes Homo Sapiens, and Human antigen. The Rabbit Anti-PTPRF Antibody has been validated for the following applications: Immunohistochemistry, and Western Blot.

Product Specs
ItemRabbit Anti-PTPRF Antibody
CompanyUnited States Biological
Price Pricing Info Supplier Page View Company Product Page
Catalog Number350802
Antibody TypePrimary
ReactivityHu
FormatSupplied as a lyophilized powder from PBS, 5% BSA, 0.05% sodium azide. Reconstitute with 200ul sterile ddH2O
ApplicationsIHC, WB
ImmunogenSynthetic peptide corresponding to aa1167-1203, EQGGEEQRRRRRQAERLKPYVAAQLDVLPETF- TLGDK, form the middle region of human PTPRF, different from the related mouse and rat sequences by four amino acids
TargetPTPRF
Hostrabbit
Concentration~0.5mg/ml (after reconstitution)
Quantity100ug
PurityPurified by immunoaffinity chromatography
Conjugate/TagUnconjugated
NCBI Full Gene Nameprotein tyrosine phosphatase receptor type F
NCBI Gene AliasesBNAH2, LAR
ClonalityPolyclonal

Add to Compare List

United States Biological

United States Biological

4 Technology Way

Salem, Massachusetts 01970

United States

Phone: (800) 520-3011
Fax: 978-594-8052

Email: service@usbio.net
tech@usbio.net

Company Profile

Website: http://www.usbio.net

Be the First to Write a Review!